Web Analysis for Malpracticelawyersphiladelphia - malpracticelawyersphiladelphia.info
Can you Deal with Your Case With out a Lawyer? Therefore kinds of instances that really should not be completed without resorting to the particular products
1.67
Rating by CuteStat
malpracticelawyersphiladelphia.info is 8 years 9 months old. It is a domain having info extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, malpracticelawyersphiladelphia.info is SAFE to browse.
PageSpeed Score
79
Siteadvisor Rating
Not Applicable
Traffic Report
Daily Unique Visitors: | Not Applicable |
Daily Pageviews: | Not Applicable |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | Not Applicable |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 1 | H2 Headings: | 10 |
H3 Headings: | 5 | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 16 |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 107.180.50.233)
Work With Robert Dorsey • How To Have More Freedom In Your Lives By Bu
- workwithrobertdorsey.com
How To Have More Freedom In Your Lives By Building Residual Income For Freedom In A Home Based Business Within Network Marketing Using The Internet
Not Applicable
$
8.95
Home - VERICUT USA
- cgtech.com
VERICUT simulates the entire CNC production and checks the NC program for collisions and errors before the real machine run.
807,243
$
1,440.00
HTTP Header Analysis
HTTP/1.1 200 OK
Date: Thu, 10 Dec 2015 14:03:42 GMT
Server: Apache/2.4.16
X-Powered-By: PHP/5.4.45
X-Pingback: http://www.malpracticelawyersphiladelphia.info/xmlrpc.php
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8
Date: Thu, 10 Dec 2015 14:03:42 GMT
Server: Apache/2.4.16
X-Powered-By: PHP/5.4.45
X-Pingback: http://www.malpracticelawyersphiladelphia.info/xmlrpc.php
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8
Domain Information
Domain Registrar: | Nimzo 38, LLC |
---|---|
Registration Date: | Jul 12, 2015, 12:00 AM 8 years 9 months 2 weeks ago |
Domain Status: |
serverTransferProhibited
addPeriod
|
Owner's E-Mail: | tgdiederich@gmail.com |
Domain Nameserver Information
Host | IP Address | Country | |
---|---|---|---|
ns57.domaincontrol.com | 97.74.108.29 | United States of America | |
ns58.domaincontrol.com | 173.201.76.29 | United States of America |
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
malpracticelawyersphiladelphia.info | A | 597 |
IP: 107.180.50.233 |
malpracticelawyersphiladelphia.info | NS | 3599 |
Target: ns58.domaincontrol.com |
malpracticelawyersphiladelphia.info | NS | 3599 |
Target: ns57.domaincontrol.com |
malpracticelawyersphiladelphia.info | SOA | 3599 |
MNAME: ns57.domaincontrol.com RNAME: dns.jomax.net Serial: 2015120700 Refresh: 28800 Retry: 7200 Expire: 604800 Minimum TTL: 600 |
malpracticelawyersphiladelphia.info | MX | 3599 |
Target: mail.malpracticelawyersphiladelphia.info |
malpracticelawyersphiladelphia.info | TXT | 3599 |
TXT: v=spf1 a mx ptr include:secureserver.net ~all |
Full WHOIS Lookup
Domain Name: MALPRACTICELAWYERSPHILADELPHIA.INFO
Domain ID: D503300000000262161-LRMS
WHOIS Server:
Referral URL: http://www.godaddy.com
Updated Date:
Creation Date: 2015-12-07T12:34:21Z
Registry Expiry Date: 2016-12-07T12:34:21Z
Sponsoring Registrar: GoDaddy.com, LLC
Sponsoring Registrar IANA ID: 146
Domain Status: serverTransferProhibited https://icann.org/epp#serverTransferProhibited
Domain Status: addPeriod https://icann.org/epp#addPeriod
Registrant ID: CR210466460
Registrant Name: Hang Ban
Registrant Organization: ANGKORING
Registrant Street: #571, GROUP1, TAVEAN,
Registrant Street: SALAKOMROEUK,
Registrant City: SIEM REAP
Registrant State/Province: SIEM REAP
Registrant Postal Code: 855
Registrant Country: KH
Registrant Phone: +855.17263579
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: angkoring@gmail.com
Admin ID: CR210466462
Admin Name: Hang Ban
Admin Organization: ANGKORING
Admin Street: #571, GROUP1, TAVEAN,
Admin Street: SALAKOMROEUK,
Admin City: SIEM REAP
Admin State/Province: SIEM REAP
Admin Postal Code: 855
Admin Country: KH
Admin Phone: +855.17263579
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: angkoring@gmail.com
Tech ID: CR210466461
Tech Name: Hang Ban
Tech Organization: ANGKORING
Tech Street: #571, GROUP1, TAVEAN,
Tech Street: SALAKOMROEUK,
Tech City: SIEM REAP
Tech State/Province: SIEM REAP
Tech Postal Code: 855
Tech Country: KH
Tech Phone: +855.17263579
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: angkoring@gmail.com
Billing ID: CR210466463
Billing Name: Hang Ban
Billing Organization: ANGKORING
Billing Street: #571, GROUP1, TAVEAN,
Billing Street: SALAKOMROEUK,
Billing City: SIEM REAP
Billing State/Province: SIEM REAP
Billing Postal Code: 855
Billing Country: KH
Billing Phone: +855.17263579
Billing Phone Ext:
Billing Fax:
Billing Fax Ext:
Billing Email: angkoring@gmail.com
Name Server: NS57.DOMAINCONTROL.COM
Name Server: NS58.DOMAINCONTROL.COM
DNSSEC: unsigned
>>> Last update of WHOIS database: 2015-12-10T14:02:45Z
Domain ID: D503300000000262161-LRMS
WHOIS Server:
Referral URL: http://www.godaddy.com
Updated Date:
Creation Date: 2015-12-07T12:34:21Z
Registry Expiry Date: 2016-12-07T12:34:21Z
Sponsoring Registrar: GoDaddy.com, LLC
Sponsoring Registrar IANA ID: 146
Domain Status: serverTransferProhibited https://icann.org/epp#serverTransferProhibited
Domain Status: addPeriod https://icann.org/epp#addPeriod
Registrant ID: CR210466460
Registrant Name: Hang Ban
Registrant Organization: ANGKORING
Registrant Street: #571, GROUP1, TAVEAN,
Registrant Street: SALAKOMROEUK,
Registrant City: SIEM REAP
Registrant State/Province: SIEM REAP
Registrant Postal Code: 855
Registrant Country: KH
Registrant Phone: +855.17263579
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: angkoring@gmail.com
Admin ID: CR210466462
Admin Name: Hang Ban
Admin Organization: ANGKORING
Admin Street: #571, GROUP1, TAVEAN,
Admin Street: SALAKOMROEUK,
Admin City: SIEM REAP
Admin State/Province: SIEM REAP
Admin Postal Code: 855
Admin Country: KH
Admin Phone: +855.17263579
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: angkoring@gmail.com
Tech ID: CR210466461
Tech Name: Hang Ban
Tech Organization: ANGKORING
Tech Street: #571, GROUP1, TAVEAN,
Tech Street: SALAKOMROEUK,
Tech City: SIEM REAP
Tech State/Province: SIEM REAP
Tech Postal Code: 855
Tech Country: KH
Tech Phone: +855.17263579
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: angkoring@gmail.com
Billing ID: CR210466463
Billing Name: Hang Ban
Billing Organization: ANGKORING
Billing Street: #571, GROUP1, TAVEAN,
Billing Street: SALAKOMROEUK,
Billing City: SIEM REAP
Billing State/Province: SIEM REAP
Billing Postal Code: 855
Billing Country: KH
Billing Phone: +855.17263579
Billing Phone Ext:
Billing Fax:
Billing Fax Ext:
Billing Email: angkoring@gmail.com
Name Server: NS57.DOMAINCONTROL.COM
Name Server: NS58.DOMAINCONTROL.COM
DNSSEC: unsigned
>>> Last update of WHOIS database: 2015-12-10T14:02:45Z